133324-ML650

SHIP2 (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2, SH2 Domain-containing Inositol-5'-phosphatase 2, SH2 Domain-containing Inositol Phosphatase 2, SHIP-2, Inositol Polyphosphate Phosphatase-like Protein 1, INPPL-1, Protein 51C, INPPL1) (MaxLight 650)

Size

£914.00

SKU:: 133324-ML650
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1159-1258 from human INPPL1 (NP_001558) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Extra Details:: MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. SHIP2 (inositol polyphosphate-5 phosphatase-like 1), contains a phosphatase domain and an SH2 (src-homology domain 2) motif. SHIP2 iswidely expressed in fibroblast and nonhematopoietic tumor cell lines. Tyrosine phosphorylation of SHIP2 occurrs in response to treatment of cells with EGF, platelet-derived growth factor (PDGF), nerve growth factor (NGF), insulin-like growth factor-1 (IGF1), or insulin. EGF and PDGF induces transient tyrosine phosphorylation of SHIP2, while treatment of cells with NGF, IGF1, or insulin results in prolonged tyrosine phosphorylation of SHIP2, indicaating that SHIP2 may play a significant role in regulation of phosphatidylinositol 3-prime-kinase signaling by growth factors and insulin. Some animal models indicate that SHIP2 is a potent negative regulator of insulin signaling and insulin sensitivity in vivo, while others suggest that SHIP2 mediates obesity resistance but not changes in glucose and insulin homeostasis. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice