133323-ML490
SHH (Sonic Hedgehog Protein, HHG-1, Sonic Hedgehog Protein N-product, Sonic Hedgehog Protein C-product) (MaxLight 490)
Size
£914.00
- SKU:
- 133323-ML490
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa181-281 from human SHH (NP_000184) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1B11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. SHH, also known as Sonic hedgehog protein, is one of three proteins in the mammalian signaling pathway family called hedgehog. It plays a key role in regulating vertebrate organogenesis, such as in the growth of digits on limbs and organization of the brain. It controls cell division of adult stem cells and has been implicated in development of some cancers. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDS* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice