133323-HRP
SHH (Sonic Hedgehog Protein, HHG-1, Sonic Hedgehog Protein N-product, Sonic Hedgehog Protein C-product) (HRP)
Size
£914.00
- SKU:
- 133323-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa181-281 from human SHH (NP_000184) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1B11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- SHH, also known as Sonic hedgehog protein, is one of three proteins in the mammalian signaling pathway family called hedgehog. It plays a key role in regulating vertebrate organogenesis, such as in the growth of digits on limbs and organization of the brain. It controls cell division of adult stem cells and has been implicated in development of some cancers. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDS* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice