133315-BIOTIN

SHC (SHC-transforming Protein 1, SH2 Domain Protein C1, SHC1, SHC-transforming Protein 3, SHC-transforming Protein A, SHCA, Src Homology 2 Domain-containing-transforming Protein C1, FLJ26504) (Biotin)

Size

£914.00

SKU:: 133315-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa171-280 from human SHC1 (AAH33925) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Shc1 is an adapter protein in the Ras-MAPkinase pathway that is involved in the regulation of cell growth and differentiation. The protein contains both PTB and SH2 domains and becomes phosphorylated on tyrosine in response to many different extracellular stimuli. human Shc1 adaptor protein is encoded by one gene but has three isoforms: p66SHC1, p52SHC1 and p46SHC1. Both p52SHC1 and p46SHC1 are associated with MAPK signaling and are highly conserved throughout evolution; p66SHC1 signaling is associated with apoptosis and is only seen in vertebrates. The SHC1 gene contains one known coding variation, which corresponding to Met225Val in the p46 isoform, Met300Val in the p52 isoform and to Met410Val in the p66 isoform. Recent studies confirms Shc1 an important candidate gene for longevity in humans. The protein is widely expressed including the neural stem cells. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice