SH3RF2 (SH3 Domain-containing RING Finger Protein 2, Putative E3 Ubiquitin-protein Ligase SH3RF2, Heart Protein Phosphatase 1-binding Protein, HEPP1, Protein Phosphatase 1 Regulatory Subunit 39, PPP1R39, POSHER, RING Finger Protein 158, RNF158)

Size

£685.00

SKU:: 133312
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa640-730 from human SH3RF2 (NP_689763.2) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALAKATTLVSTASGTQTVFPSK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.