133306
SH3GL2 (Endophilin-A1, EEN-B1, Endophilin-1, SH3 Domain Protein 2A, SH3 Domain-containing GRB2-like Protein 2, CNSA2, SH3D2A, FLJ20276, FLJ25015)
Size
£685.00
- SKU:
- 133306
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa64-124 from human SH3GL2 (NM_003026, NP_003017) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5A6
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice