133306-FITC

SH3GL2 (Endophilin-A1, EEN-B1, Endophilin-1, SH3 Domain Protein 2A, SH3 Domain-containing GRB2-like Protein 2, CNSA2, SH3D2A, FLJ20276, FLJ25015) (FITC)

Size

£914.00

SKU:: 133306-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa64-124 from human SH3GL2 (NM_003026, NP_003017) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5A6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.