133291
SH2D3A (SH2 domain containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201)
Size
£685.00
- SKU:
- 133291
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa460-575 from SH2D3A (NP_005481) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B11
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- NSP1 is a cytoplasmic signaling intermediate that functions as an adaptor or scaffolding protein to integrate growth factor receptor and integrin signals. The protein contain an N-terminal SH2 domain, a central proline:serine-rich region, and a C-terminal sequence. The protein is phosphorylated in response to insulin and EGF (and insulin-like growth factor I and heregulin) indicating that NSP1 is a common target for a variety of growth factor receptors. The protein is thus involved in a process by which receptor tyrosine kinase and integrin receptors control the c-Jun N-terminal kinase:stress-activated protein kinase pathway. Protein expression is usually restricted to tissues with secretory epithelial cells. The gene encoding for human NSP1 is localized in the chromosomal region 19p13.3. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFVRRLLWGSRGAGAPRAERFEKFQRVLGVLSQRLEPD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice