SH2D1B (SH2 Domain-containing Protein 1B, EWS/FLI1-activated Transcript 2, EAT-2, EAT2)

Size

£685.00

SKU:: 133286
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa54-132 from human SH2D1B with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Plays a role in controlling signal transduction through at least four receptors, CD84, SLAMF1, LY9 and CD244, expressed on the surface of professional antigen-presenting cells. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications have not been tested. Recommended Dilutions: ELISA (Sandwich): 0.3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: RIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.