SGCB (Beta-Sarcoglycan, Beta-SG, Sarcoglycan, beta, SGC, 43kD Dystrophin-associated Glycoprotein, 43DAG, A3b, LGMD2E)

Size

£685.00

SKU:: 133249
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa87-196 from human SGCB with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Beta-sarcoglycan is found in normal muscle but has a differential expression in certain instances of muscular dystrophy. This antibody will help identify the presence or absence of beta-sarcoglycan. Applications: Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: WAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.