SFRS6 (Serine/Arginine-rich Splicing Factor 6, Pre-mRNA-splicing Factor SRP55, Splicing Factor, Arginine/Serine-rich 6, SFRS6, SRP55, FLJ08061, MGC5045)

Size

£685.00

SKU:: 133234
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-76 from human SFRS6 (NP_006266) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.