SFRP3 (Secreted Frizzled Related Protein 3, sFRP-3, SRFP3, Frizzled-related Protein 1, FIZ, FRE, Frezzled, Fritz, FRP, FRZB, FRZB-PEN, Frzb1, FrzB-1, hFIZ, OS1)

Size

£685.00

SKU:: 133225
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa102-190 from human FRZB (NP_001454) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appears to be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bone development. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.