Splicing Factor 1 (SF1, Mammalian Branch Point-binding Protein, BBP, mBBP, Transcription Factor ZFM1, Zinc Finger Gene in MEN1 Locus, ZFM1, Zinc Finger Protein 162, ZNF162, D11S636, ZCCHC25)

Size

£685.00

SKU:: 133214
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-111 of human SF1 (NP_004621) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA sequence: MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.