Serum Amyloid A1 (SAA1, Amyloid Fibril Protein AA, Amyloid Protein A, MGC111216, PIG4, SAA2, Serum Amyloid A Protein Precursor, SAA, Tumor Protein p53 Inducible Protein 4, TP53I4)

Size

£760.00

SKU:: 133201
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human SAA1, aa1-122 (NP_000322.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Human Serum Amyloid A protein-1 (SAA-1) is a multifunctional apolipoprotein produced by hepatocytes in response to proinflammatory cytokines. It is secreted as a 12kD, 104aa, nonglycosylated polypeptide that displaces apoA1 in the HDL 3 complex. The SAA-1 gene is one of three SAA genes in human, and it shows multiple alleles that are race dependent. The SAA-1 gene product differs from the SAA-2 gene product by only seven amino acids. Circulating SAA-1 shows multiple proteolytically-generated isoforms, with anywhere from one-to-three amino acids being cleaved from either the N- or C-terminus. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.