133199-ML490
SERTAD1 (SERTA Domain-containing Protein 1, CDK4-binding Protein p34SEI1, SEI1, SEI-1, Transcriptional Regulator Interacting with the PHD-bromodomain 1, TRIP-Br1) (MaxLight 490)
Size
£914.00
- SKU:
- 133199-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant corresponding to aa1-237 from human SERTAD1 (AAH02670) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3H4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Transcriptional regulator interacting with the PHD-bromodomain 1, TRIP-Br1, CDK4-binding protein p34SEI1, SEI-1. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: FLISA: 1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSPQQSEPDLRHLVLVVNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGPPGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERPPGPGR* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice