SERPINE2 (Glia-derived Nexin, GDN, Peptidase Inhibitor 7, PI-7, Protease Nexin 1, PN-1, Protease Nexin I, Serpin E2, PI7, PN1)

Size

£685.00

SKU:: 133189
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa72-172 from human SERPINE2 (NP_006207) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.