133182-BIOTIN
SERPINB9 (Serpin B9, Cytoplasmic Antiproteinase 3, CAP-3, CAP3, Peptidase Inhibitor 9, PI-9, PI9) (Biotin)
Size
£914.00
- SKU:
- 133182-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa279-376 from human SERPINB9 (NP_004146) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Proteinase inhibitor 9 (PI-9, also designated cytoplasmic antiproteinase 3, or CAP3) is a 42kD member of the ovalbumin family of serpins that is expressed in placenta, lung and cytotoxic lymphocytes. PI-9 is a potent inhibitor of granzyme B and of granzyme B-mediated apoptosis, and is also an inhibitor of capase-1 and, to a smaller extent, caspase-4 and caspase-8. PI-9 expression is also upregulated in response to inflammatory stimuli. This upregulation protects cells from apoptosis induced by endogenously expressed or released granzyme B, particulary during target cell killing. Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice