133151-ML650
Serotonin Receptor 5A (5-Hydroxytryptamine 5A Receptor, 5-Hydroxytryptamine Receptor 5A, 5-HT5A, 5-HT-5A, 5HT5A Receptor, 5-HT5A Receptor, 5-HT5AR, HTR5A, MGC138226) (MaxLight 650)
Size
£914.00
- SKU:
- 133151-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa223-282 from human HTR5A (NP_076917) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 10D3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. The histochemical antibody for 5-HT5A receptor is generated in a rabbit against synthetic peptide sequence corresponding to aa17-34 of the rat 5-HT5A receptor. The antibody produces 4+ (maximum) labeling of 5-HT5A receptor at dilutions of 1/100-1/300 using both indirect immunofluorescence and biotin-streptavidin/HRP technique in rat cortex and hippocampus. Optimal dilution will vary depending upon fixation, labeling technique and/or detection system; therefore, a dilution series is recommended. The antibody was characterized by immunoblotting and immunohistochemistry. Immunoblots of rat brain extracts revealed the presence of two bands at molecular weights of 41 and 47kD. The lower weight band agrees with the calculated molecular weight based on amino acid sequence. The higher weight may represent glycosylated receptor protein. Immunohistochemical staining of rat brain correlates well with Northern blot analysis and in situ hybridization studies. Immunolabeling is completely abolished by preadsorption with synthetic rat 5-HT5A receptor (17-34). BlastP database sequence homology searches indicate that the amino acid sequence is unique to rat and mouse 5-HT5A receptor. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice