Septin 11 (Septin-11, SEPT11)

Size

£685.00

SKU:: 133142
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa71-180 from human SEPT11 (AAH08083) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Filament-forming cytoskeletal GTPase. May play a role in cytokinesis. May play a role in the cytoarchitecture of neurons, including dendritic arborization and dendritic spines, and in GABAergic synaptic connectivity. During Listeria monocytogenes infection, not required for the bacterial entry process, but restricts its efficacy. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYID Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.