SEPT2 (Septin-2, Neural Precursor Cell Expressed Developmentally Down-regulated Protein 5, NEDD-5, DIFF6, KIAA0158, NEDD5)

Size

£685.00

SKU:: 133132
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-371 from human SEPT2 (AAH33559) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. This gene encodes a protein associated with the tau-based paired helical filament core, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. SEPT2, otherwise known as septin-2, is a cytoskeletal GTPase and member of the septin family, essential for the formation of filaments, in conjunction with SEPT6 and SEPT7. SEPT2 plays an important role during mitosis progression/cytokinesis, in the correct organization of the actin cytoskeleton, and maintains polyGlu microtubule tracks, thereby facilitating epithelial cell vesicle transport. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAALNTRKTLLWEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice