133125-BIOTIN
SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (Biotin)
Size
£934.00
- SKU:
- 133125-BIOTIN
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human SEPT1, aa1-367 (NP_443070.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. This gene encodes a protein associated with the tau-based paired helical filament core, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. SEPT2, otherwise known as septin-2, is a cytoskeletal GTPase and member of the septin family, essential for the formation of filaments, in conjunction with SEPT6 and SEPT7. SEPT2 plays an important role during mitosis progression/cytokinesis, in the correct organization of the actin cytoskeleton, and maintains polyGlu microtubule tracks, thereby facilitating epithelial cell vesicle transport. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice