SENP7 (Sentrin-specific Protease 7, SUMO-1-specific Protease 2, Sentrin/SUMO-specific Protease SENP7, KIAA1707, SSP2, SUSP2)

Size

£685.00

SKU:: 133116
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-111 from human SENP7 (NP_065705) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: SENP7 is a protease that may be involved in two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature conjugatable forms and/or deconjugation of SUMO1, SUMO2 and SUMO3 from targeted substrate proteins. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNKVISLDHKNKKHIRGCPVTSRSSPERIPRVILTNVLGTELG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.