SCYL1 (SCY1-like Protein 1, N-terminal Kinase-like Protein, Coated Vesicle-associated Kinase of 90kD, CVAK90, GKLP, HT019, NKTL, NTKL, P105, Telomerase Regulation-associated Protein, TRAP, Telomerase Transcriptional Element-interacting Factor, TEIF, Teratoma-associated Tyrosine Kinase, TAPK)

Size

£685.00

SKU:: 133047
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa373-472 from human SCYL1 (AAH09967) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.