133047-FITC

SCYL1 (SCY1-like Protein 1, N-terminal Kinase-like Protein, Coated Vesicle-associated Kinase of 90kD, CVAK90, GKLP, HT019, NKTL, NTKL, P105, Telomerase Regulation-associated Protein, TRAP, Telomerase Transcriptional Element-interacting Factor, TEIF, Teratoma-associated Tyrosine Kinase, TAPK) (FITC)

Size

£914.00

SKU:: 133047-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa373-472 from human SCYL1 (AAH09967) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.