Stonin 1 (Stonin-1, STON1, STN1, SALF, Stoned B-like Factor, SBLF, STNB1)

Size

£685.00

SKU:: 132953
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa141-250 from human SALF (NP_758515) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5F12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.