132948-P

SAE1, Recombinant, Human, GST Tag (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A)

Size

£800.00

SKU:: 132948-P
Molecular Weight:: 63.8
Purity:: Purified by Glutathione Sepharose affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer.
Extra Details:: Full length recombinant corresponding to aa1-346 from SAE1 with GST tag. MW of the GST tag alone is 26kD. The ubiquitin-like protein SUMO-1 is conjugated to a variety of proteins including Ran GTPase-activating protein 1 (RanGAP1), IkappaB alpha, and PML. SUMO-1-modified proteins display altered subcellular targeting and/or stability. SAE1 is capable of catalyzing the ATP-dependent formation of a thioester linkage between SUMO-1 and SAE2. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications have not been tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Shipping Conditions:: Blue Ice