S100P (S100 Calcium-binding Protein P, Protein S100-P, Migration-inducing Gene 9 Protein, MIG9, Protein S100-E, S100E)

Size

£685.00

SKU:: 132937
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-96 from human S100P (AAH06819) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: S100P is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and they are involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100P, in addition to binding Ca2+, also binds Zn2+ and Mg2+. It may play a role in the etiology of prostate cancer. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.