132934-APC
S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein 14, MRP14, MRP-14, NIF, P14, Protein S100-A9) (APC)
Size
£927.00
- SKU:
- 132934-APC
- Purity:
- Purified by Protein A affinity chromatography
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant corresponding to aa1-114 from human S100A9 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4G9
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- S100 Calcium Binding Protein A9, also known as Calgranulin B, belongs to the S100 family containing EF-hand type Ca2+-binding proteins. It is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation, and associated with the disease cystic fibrosis. S100A9 has been implicated in the abnormal differentiation of myeloid cells in the stroma of cancer. This protein may function in the inhibition of casein kinase. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice