132932-FITC

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF, p8, Protein S100-A8, Urinary Stone Protein Band A) (FITC)

Size

£914.00

SKU:: 132932-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-94 from human S100AB (AH05928) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: S100 Calcium Binding Protein A8 (S100A8) is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A8 may function in the inhibition of casein kinase and as a cytokine. Altered expression of S100A8 is associated with the disease cystic fibrosis. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice