S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF, p8, Protein S100-A8, Urinary Stone Protein Band A)

Size

£760.00

SKU:: 132931
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human S100AB, aa1-94 (AH05928).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: S100 Calcium Binding Protein A8 (S100A8) is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A8 may function in the inhibition of casein kinase and as a cytokine. Altered expression of S100A8 is associated with the disease cystic fibrosis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.