132923-BIOTIN
S100A4 (Protein S100-A4, Calvasculin, Metastasin, Placental Calcium-binding Protein, Protein Mts1, S100 Calcium-binding Protein A4, CAPL, MTS1) (Biotin)
Size
£914.00
- SKU:
- 132923-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-102 from human S100A4 (AAH16300) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F12-1G7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- S100 calcium binding protein A4 (S100A4) is a member of the S100 family of calcium-binding proteins that contain two Ca(2+)-binding sites including a canonical EF-hand motif. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells. S100A4 interacts with cytoskeletal proteins and enhances metastasis of several types of cancer cells. It is secreted by unknown mechanisms, thus, paracrinely stimulating a variety of cellular responses, including angiogenesis and neuronal growth. S100A4 has been shown to be a prognostic marker in a number of human cancers, including esophageal-squamous cancers, non-small lung cancers, primary gastric cancers, malignant melanomas, prostate cancers, bladder cancers, and pancreatic carcinomas. The universality of S100A4 expression in a variety of cancers illustrates the potential use of S100A4 as a marker for tumor metastasis and disease progression. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 15ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice