132920
S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2)
Size
£685.00
- SKU:
- 132920
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-98 from human S100A2 (AAH02829) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3H8
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- S100A2 is a 10kD member of the S100 family, EF-hand superfamily of Ca-binding proteins. It is expressed by multiple cell types, including keratinocytes, chondrocytes, and bronchial epithelium. S100A2 regulates both Ca and Zn (in human) within cells, and increases p53 activity. It forms both noncovalent and covalent homodimers, and a homotetramer under certain conditions. Human S100A2 is 98aa in length. It contains two EF-hand motifs (aa13-48 and 51-86) plus a calcium (aa64-75) and zinc (aa17-22) binding site. There is one potential alternative splice form that shows a 40aa insertion after Gly48. Full-length human S100A2 shares 89%, 85% aa identity with bovine and canine S100A2, respectively. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 15ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice