132918
S100A13 (S100 Calcium-binding Protein A13, Protein S100-A13)
Size
£685.00
- SKU:
- 132918
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-99 from human S100A13 (NP_005970) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3A7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- S100A13, also known as S100 calcium binding protein A13, is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. It plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. S100A13 protein has been shown to interact with SYT1 and FGF1. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice