S100A12 (Protein S100-A12, CGRP, Calcium-binding Protein in Amniotic Fluid 1, CAAF1, Calgranulin-C, CAGC, Extracellular Newly Identified RAGE-binding Protein, EN-RAGE, Neutrophil S100 Protein, S100 Calcium-binding Protein A12, p6)

Size

£685.00

SKU:: 132916
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-92 from human S100A12 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: EN-RAGE, also known as S100A12 and Calgranulin C, is a 10kD secreted molecule that belongs to the S100 family of calcium binding proteins. EN-RAGE contains two EF hand domains and forms dimers and hexamers in solution. EN-RAGE is overexpressed at sites of inflammation and interacts with RAGE on endothelial cells, lymphocytes, and monocytes to promote inflammatory responses. Human EN-RAGE shares 66% and 70% aa sequence identity with bovine and porcine EN-RAGE, respectively; mouse and rat orthologs have not been identified. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.