S100A10 (Protein S100-A10, Calpactin I Light Chain, Calpactin-1 Light Chain, Cellular Ligand of Annexin II, S100 Calcium-binding Protein A10, p10 Protein, p11, ANX2LG, CAL1L, CLP11, MGC111133)

Size

£685.00

SKU:: 132914
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-98 from human S100A10 (AAH15973) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D2-F1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: S100A10/p11 belongs to the S-100 calcium binding protein family, although it has had crucial aa substitutions and deletions that render it incapable of binding calcium. p11 forms a heterotetrameric complex with annexin II. p11 functions as an auxiliary protein and has been shown to interact directly the potassium channel TASK-1. It is essential for TASK1 trafficking to the plasma membrane. p11 also increases the localization of 5HT1B receptors to the cell surface. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.