S100A1 (S100 Calcium-binding Protein A1, Protein S100-A1, S-100 Protein alpha Chain, S-100 Protein Subunit alpha, S100 Calcium-binding Protein A1, S100A)

Size

£685.00

SKU:: 132913
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa-1-75 from human S100A1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Protein S100-A1 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. Protein S100-A1 exists as a dimer of either two alpha chains, two beta chains or one alpha and one beta chain. It weakly binds calcium but binds zinc very tightly and distinct binding sites with different affinities exist for both ions on each monomer. This protein is highly prevalent in heart and to a lesser extent in skeletal muscle and brain. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice