132908-BIOTIN
RXRG (Retinoic Acid Receptor RXR-gamma, Nuclear Receptor Subfamily 2 Group B Member 3, Retinoid X Receptor gamma, NR2B3) (Biotin)
Size
£914.00
- SKU:
- 132908-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-76 from human RXRG (NP_008848) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 6H1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Retinoid X receptor G (RXRG or RXR gamma) is a nuclear receptor that mediates the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. RXRs as a whole exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulate their transcription.HeLa cell lysate Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITS* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice