RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2)

Size

£685.00

SKU:: 132893
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa416-525 from human RUNX1T1 (NP_004340) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5A12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Transcription regulator that excerts its function by binding to histone deacetylases and transcription factors. Can repress transactivation mediated by TCF12. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.