RUNX1 (Runt-related Transcription Factor 1, Acute Myeloid Leukemia 1 Protein, Core-binding Factor Subunit alpha-2, CBF-alpha-2, Oncogene AML-1, Polyomavirus Enhancer-binding Protein 2 alpha B Subunit, PEA2-alpha B, PEBP2-alpha B, SL3-3 Enhancer Factor 1 alpha B Subunit, SL3/AKV Core-binding Factor alpha B Subunit, AML1, CBFA2)

Size

£685.00

SKU:: 132891
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa210-310 from human RUNX1 (NP_001001890.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: RUNX1 (runtrelated transcription factor 1), also known as CBFA (corebinding factor a2) or AML1, is a heterodimeric transcription factor that plays a role in normal hematopoiesis. Multiple splice variants exist. Defects in RUNX1 are associated with several types of leukemia. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.