132891-FITC
RUNX1 (Runt-related Transcription Factor 1, Acute Myeloid Leukemia 1 Protein, Core-binding Factor Subunit alpha-2, CBF-alpha-2, Oncogene AML-1, Polyomavirus Enhancer-binding Protein 2 alpha B Subunit, PEA2-alpha B, PEBP2-alpha B, SL3-3 Enhancer Factor 1 alpha B Subunit, SL3/AKV Core-binding Factor alpha B Subunit, AML1, CBFA2) (FITC)
Size
£914.00
- SKU:
- 132891-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa210-310 from human RUNX1 (NP_001001890.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4E7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- RUNX1 (runtrelated transcription factor 1), also known as CBFA (corebinding factor a2) or AML1, is a heterodimeric transcription factor that plays a role in normal hematopoiesis. Multiple splice variants exist. Defects in RUNX1 are associated with several types of leukemia. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice