RPS6KA3 (ISPK1, MAPKAPK1B, RSK2, Ribosomal Protein S6 Kinase alpha-3, 90kD Ribosomal Protein S6 Kinase 3, Insulin-stimulated Protein Kinase 1, MAP Kinase-activated Protein Kinase 1b, Ribosomal S6 Kinase 2, pp90RSK2)

Size

£685.00

SKU:: 132823
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-96 from human RPS6KA3 (NP_004577) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.