RPS3 (40S Ribosomal Protein S3, FLJ26283, FLJ27450, MGC87870, OK/SW-cl.26)

Size

£685.00

SKU:: 132818
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa144-244 from human RPS3 (NP_000996) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: RPS3 (Ribosomal protein S3) is a component of the 40S ribosomal subunit and is an an essential but previously unkown subunit of NF-kappaB involved in the regulation of key genes in rapid cellular activation responses. RPS3 interacts with nm23-H1. The expression of RPS3 reduces the secretion of MMP-9 and the invasive metastatic potential in HT1080 cells. The phosphorylated ERK is reduced by the expression of RPS3. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.