132818-HRP
RPS3 (40S Ribosomal Protein S3, FLJ26283, FLJ27450, MGC87870, OK/SW-cl.26) (HRP)
Size
£914.00
- SKU:
- 132818-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa144-244 from human RPS3 (NP_000996) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2A8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- RPS3 (Ribosomal protein S3) is a component of the 40S ribosomal subunit and is an an essential but previously unkown subunit of NF-kappaB involved in the regulation of key genes in rapid cellular activation responses. RPS3 interacts with nm23-H1. The expression of RPS3 reduces the secretion of MMP-9 and the invasive metastatic potential in HT1080 cells. The phosphorylated ERK is reduced by the expression of RPS3. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice