132818-BIOTIN
RPS3 (40S Ribosomal Protein S3, FLJ26283, FLJ27450, MGC87870, OK/SW-cl.26) (Biotin)
Size
£914.00
- SKU:
- 132818-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa144-244 from human RPS3 (NP_000996) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2A8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- RPS3 (Ribosomal protein S3) is a component of the 40S ribosomal subunit and is an an essential but previously unkown subunit of NF-kappaB involved in the regulation of key genes in rapid cellular activation responses. RPS3 interacts with nm23-H1. The expression of RPS3 reduces the secretion of MMP-9 and the invasive metastatic potential in HT1080 cells. The phosphorylated ERK is reduced by the expression of RPS3. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice