RPS2 (40S Ribosomal Protein S2, 40S Ribosomal Protein S4, Protein LLRep3, RPS4, MGC102851, MGC117344, MGC117345)

Size

£685.00

SKU:: 132811
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa198-294 from human RPS2 (NP_002943) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Citrullinated by PADI4 in the Arg/Gly-rich region. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.