132802-PE

RPP40 (Ribonuclease P Protein Subunit p40, RNaseP Protein p40, RNase P Subunit 1, RNASEP1) (PE)

Size

£914.00

SKU:: 132802-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa295-363 from human RPP40 (NP_006629) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit for recombinant GST tagged RPP40 is 0.1ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.