RPL18A (60S Ribosomal Protein L18a)

Size

£685.00

SKU:: 132780
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa77-177 from human RPL18A (NP_000971) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL18A is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18AE family of ribosomal proteins. It is located in the cytoplasm. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.