AKAP17A (A-kinase Anchor Protein 17A, AKAP-17A, 721P, B-lymphocyte Antigen, CCDC133, CXYorf3, DXYS155E, Protein Kinase A-anchoring Protein 17A, PRKA17A, Protein XE7, RP13-297E16.1, Splicing Factor, Arginine/serine-rich 17A, SFRS17A, XE7, XE7Y)

Size

£685.00

SKU:: 132737
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa53-157 from RP13-297E16.1 (NP_005079) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.