ROR1 (Tyrosine-protein Kinase Transmembrane Receptor ROR1, Neurotrophic Tyrosine Kinase, Receptor-related 1, NTRKR1, MGC99659)

Size

£685.00

SKU:: 132728
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa294-393 from human ROR1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ROR1 belongs to the ROR family of receptor tyrosine kinases, which are characterized by: the extracellular immunoglobulin domain, a cysteine-rich domain that resembles the Wnt binding sites of Frizzled proteins, a kringle domain and an intracellular kinase domain. Human ROR1 shares 97-58aa sequence identity with mouse ROR1 and human ROR2, respectively. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.