132728-HRP
ROR1 (Tyrosine-protein Kinase Transmembrane Receptor ROR1, Neurotrophic Tyrosine Kinase, Receptor-related 1, NTRKR1, MGC99659) (HRP)
Size
£914.00
- SKU:
- 132728-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa294-393 from human ROR1 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1B4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- ROR1 belongs to the ROR family of receptor tyrosine kinases, which are characterized by: the extracellular immunoglobulin domain, a cysteine-rich domain that resembles the Wnt binding sites of Frizzled proteins, a kringle domain and an intracellular kinase domain. Human ROR1 shares 97-58aa sequence identity with mouse ROR1 and human ROR2, respectively. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice